IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS Note: The complete sequence may
include tag sequence, target protein sequence, linker sequence
and extra sequence that is translated with the protein sequence
for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant
protein is critical to your application, please explicitly
request the full and complete sequence of this protein before
ordering.
蛋白標(biāo)簽:
N-terminal GST-tagged
產(chǎn)品提供形式:
Liquid or
Lyophilized powder
Warning: in_array() expects parameter 2 to be array, null given in /www/web/cusabio_cn/public_html/caches/caches_template/default/content/show_product_protein.php on line 662
Note: We will
preferentially ship the format that we have in stock, however,
if you have any special requirement for the format, please
remark your requirement when placing the order, we will prepare
according to your demand.
緩沖液:
If the delivery form is liquid, the default storage buffer is
Tris/PBS-based buffer, 5%-50% glycerol. Note: If you have
any special requirement for the glycerol content, please remark
when you place the order. If the delivery form is lyophilized powder, the buffer before
lyophilization is Tris/PBS-based buffer, 6% Trehalose.
儲(chǔ)存條件:
Store at -20°C/-80°C upon receipt, aliquoting is
necessary for
mutiple use. Avoid repeated freeze-thaw cycles.
保質(zhì)期:
The shelf life is related to many factors, storage
state,
buffer ingredients, storage temperature and the stability of the
protein
itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C.
The
shelf life of lyophilized form is 12 months at -20°C/-80°C.
貨期:
Basically, we can dispatch the products out in 1-3 working days
after receiving your orders. Delivery time may differ from different
purchasing way or location, please kindly consult your local
distributors for specific delivery time.
Note: All of our
proteins are default shipped with normal blue ice packs, if you
request to ship with dry ice, please communicate with us in
advance
and extra fees will be charged.
注意事項(xiàng):
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC.; Associates with IL23A to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of proinflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis.
基因功能參考文獻(xiàn):
Effect of polymorphisms in IL-12B p40, IL-17A and IL-23 A/G genes on the response of psoriatic patients to narrowband UVB. PMID: 29763989
showed that IL-12B A1188C (rs3212227) can contribute to the progression of the disease in the Czech population PMID: 30069682
Study confirms an association between IL12B and IL23R genetic polymorphism and psoriasis vulgaris (with a protective effect of minor alleles). PMID: 29454820
IL-12 B gene AA genotype presented more frequently in late stages of Hepatitis C virus chronically ill patients, while, CC genotype had no significant association with staging of liver disease and had low frequency especially in late stages of liver disease. PMID: 28595541
Frequency of IL-12B AA (rs6871626) genotype was increased in Ankylosing Spondylitis patients. Interleukin IL-12B AA (rs6871626) gene polymorphisms could serve as promising biomarkers for diagnosis and prognosis in Ankylosing Spondylitis patients. PMID: 29200018
The demonstrated allelic expression imbalance supports the idea that the IL12B risk haplotype confers susceptibility not only to Crohn's disease onset but to also relapse through increased IL12B mRNA expression. PMID: 28229296
the present study IL-12B gene status was evaluated in 50 new sputum smear-positive pulmonary tuberculosis patients. PMID: 28697396
The rs17860508 polymorphism in the IL12B promoter region may influence the risk of developing ovarian endometriosis by altering the endometrial expression of IL12B of in Northern Chinese women. PMID: 29738836
The rs6871626 single nucleotide polymorphism in IL-12B is associated with the pathophysiology of Takayasu arteritis. PMID: 28874185
Human neutrophil elastase is involved in transactivation of TLR4 through activation of DUOX-2/EGFR and synergistically enhances IL-12p40 production by macrophages stimulated with LPS. PMID: 27282560
our results suggested a significant association between IL-12B 3'-UTR and rs6887695 SNPs and ADs. PMID: 27068848
Single-nucleotide-polymorphisms of IL12B may be considered a high-risk factor for Takayasu arteritis in Chinese Han population PMID: 28160070
IL-12B -1188 C allele may be a protective factor against asthma in East Asians PMID: 28287286
The low expression of HDAC3 and overexpession of inflammatory cytokines (IL-18, IL-12 and TNF-alpha) in intrahepatic cholestasis of pregnancy may be involved in liver cell apoptosis and in the pathophysiology of the disease. PMID: 28697498
Identification of PARP-1 as a unique regulator of Il12b transcription in response to inflammatory insults in an allele-differentiating manner PMID: 28219892
Pre-incubation with IL-12 was able to restore IFN-gamma production and the cytotoxicity capacities of NK cells. This cytokine may therefore be considered as a potential treatment candidate in traumatic brain injury patients with immune suppression. PMID: 26387630
Visceral leishmaniasis in two patients with IL-12p40 and IL-12Rbeta1 deficiencies PMID: 27873456
NOD2 rs3135500 and IL12B rs1368439 SNPs were not genetic risk factors for colorectal cancer in the studied Iranian population. PMID: 27426943
IL-12B gene polymorphisms were not related with rheumatoid arthritis (RA). However, rs6887695 was associated with RA in Asian patients PMID: 27155343
Suggest Il12B SNPs as genetic marker of disease severity in Takayasu arteritis severity. PMID: 25783557
The results of this study suggested that rs6887695 SNP in IL12B gene increase susceptibility to relapsing-remitting multiple sclerosis. PMID: 28276258
these meta-analyses demonstrated that IL-12B rs3212227 and rs6887695 polymorphisms do not confer susceptibility to rheumatoid arthritis [data synthesis] PMID: 27312970
Findings indicate that IL-12p40 + 1188A/C polymorphism as well as IL-12p70 protein levels may be associated with rheumatoid arthritis (RA) in the Polish population. PMID: 27896842
The present meta-analysis suggests that the IL12B +1188A/C (rs3212227) polymorphism might be associated with genetic susceptibility to autoimmune diseases, such as type 1 diabetes, rheumatoid arthritis and Behcet disease, but not Graves disease and ankylosing spondylitis. PMID: 26915668
this study shows that IL-12B gene polymorphism does not contribute to the risk of hepatocellular carcinoma on top of chronic hepatitis C virus infection in Egyptian patients PMID: 27819525
this study has demonstrated (i) a significant association of -1082GG IL-10 genotype with susceptibility to autoimmune thyroid disease and (ii) the concomitant presence of IL-12B +1188CC and IL-10-1082 GG genotype contributes to the development and progression of Hashimoto's thyroiditis PMID: 27774749
Il-12B SNPs have an association with anti-HBs Ab production after vaccination in healthy Korean infants. PMID: 28051794
Our results reveal that the IL12A rs568408 variant may be a marker SNP for risk of both HBV clearance and HBV-related hepatocellular carcinoma development PMID: 26631030
this study shows that the Il-12 genetic polymorphisms is associated with susceptibility to tuberculosis in patients and their household contacts in India PMID: 27108964
High IL12 levels can inhibit Candida albicans colonizing the gastrointestinal tract of children and adolescents with diabetes mellitus type 1. PMID: 28127111
this study shows that IL-12B gene polymorphism is genetic risk factor for systemic lupus erythematosus in the Polish population, and that it predicts disease phenotype PMID: 27059274
analysis of cytokine gene polymorphisms suggests that IL-12 gene may play impact on specific pathogenesis of ophthalmopathy in Korean children with early onset autoimmune thyroid disease. PMID: 26850223
IL-12 polymorphism rs3212227 might not be a critical risk factor for Preeclampsia in Chinese Han women. PMID: 27148908
a tendency of a higher prevalence of the genotype IL-12p40 pro1.1 in systemic arthritis and in rheumatoid factor negative polyarthritis was observed but not significant PMID: 26667304
genetic polymorphism is associated with psoriasis in the South Indian Tamils PMID: 26472011
genetic polymorphism is associated with allergic rhinitis in Chinese patients PMID: 26663019
The IL23R polymorphisms rs10889677, rs7517847, and the IL12B polymorphism rs3212227 are not associated with multiple sclerosis risk. PMID: 26000455
IL-12 immunomodulation delays the onset of lethal peritoneal disease of ovarian cancer. PMID: 26430781
variant IL-12p40 1188C/A genotype was AA (72.92%), AC (23.96%), and CC (3.13%%) in patients as compared to 65%, 30%, and 5%, respectively, in controls. PMID: 26516307
the IL-12B rs3212227 AC and AC+CC genotypes are associated with rheumatoid arthritis risk in older patients,rheumatoid factor positive patients and anti-cyclic peptide antibodies negative patients PMID: 26375522
High serum IL-12 levels associated with increased densities of peritumoral CD8(+) T cells, intraepithelial CD3(+) T cells and intratumoral neutrophils, while high serum CCL4 levels associated with increased densities of peritumoral CD68(+) cells PMID: 26874795
These observations indicate a HDAC1-mediated IL-12B gene expression suppression by live, virulent Mycobacterium tuberculosis to subvert the immune system to survive and replicate in the host. PMID: 26697414
IL-12p40 response to in vitro stimulation in patients with Mendelian susceptibility to mycobacterial disease was below normal levels. PMID: 25201764
8 SNPs (rs10045431, rs11167764, rs3212227, rs6556412, rs6556416, rs6871626, rs6887695 and rs7709212) were genotyped in Han ankylosing spondylitis patients and controls. rs6871626 may be associated AS susceptibility and activity. PMID: 26103568
Replicating the association of single-nucleotide polymorphisms in the TNFAIP3, IL12B and IL23R genes with psoriasis vulgaris, in subjects from different ethnic backgrounds, underlines their importance in the pathogenesis of the disease. PMID: 25406098
balance of IL-23 vs IL-12/IL-27 signals into CD4(+) effector T cells determines whether tissue inflammation is perpetuated or resolves PMID: 24796719
Compared with the IL-12B-AA genotype, CC and combined CC/AC genotypes were associated with a significant decreased risk of Hepatitis C virus infection in Chinese hemodialysis patients. PMID: 25613737
These results show that IL-15 and IL-12 combination has the ability to expand the selective depletion of invariant natural killer T cells in vitro in HIV-infected individuals. PMID: 24748538
The risk of gastric cardiac adenocarcinoma associated with the IL12B rs3212227 T > G polymorphism was evident among Chinese female patients and Chinese patients who never smoked or consumed alcoholic drinks. PMID: 24529168
Based on these results, we believe that the increased levels of IL-12p40 and IL-16 are associated with an ongoing inflammatory response in obese individuals and could lead to the development of disease conditions related to obesity. PMID: 25710036